5TGH: SNX5 PX domain
Structure of the SNX5 PX domain in complex with chlamydial protein IncE in space group P32. Determined by X-ray diffraction at 2.8 Å resolution. Released 3 May 2017.
- Method
- X-ray diffraction
- Resolution
- 2.8 Å
- Organisms
- Homo sapiens, Chlamydia trachomatis
- Chains
- 8
- Atoms
- 5,190
- Mol. weight
- 79.11 kDa
- Released
- 3 May 2017
Explore 5TGH in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5TGH contains 34 α-helices and 23 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 7 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 31-41 | 11 | 1 |
| β-strand | 44-53 | 10 | 1 |
| β-strand | 62-68 | 7 | 1 |
| α-helix | 69-81 | 13 | |
| α-helix | 83-85 | 3 | |
| α-helix | 89-97 | 9 | |
| α-helix | 100-111 | 12 | |
| α-helix | 118-152 | 35 | |
| α-helix | 156-158 | 3 | |
| α-helix | 160-167 | 8 | |
Chain B: 2 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 113-117 | 5 | 1 |
| α-helix | 118-120 | 3 | |
| α-helix | 123-125 | 3 | |
| β-strand | 126-129 | 4 | 1 |
Chain C: 7 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 31-34 | 4 | 2 |
| β-strand | 37-41 | 5 | 2 |
| β-strand | 44-53 | 10 | 2 |
| β-strand | 62-68 | 7 | 2 |
| α-helix | 69-80 | 12 | |
| α-helix | 83-85 | 3 | |
| α-helix | 90-97 | 8 | |
| α-helix | 100-111 | 12 | |
| α-helix | 118-152 | 35 | |
| α-helix | 156-158 | 3 | |
| α-helix | 160-167 | 8 | |
Chains D and F: 2 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 113-117 | 5 | 2 |
| α-helix | 118-119 | 2 | |
| α-helix | 124-125 | 2 | |
| β-strand | 126-130 | 5 | 2 |
Chain E: 7 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 31-34 | 4 | 3 |
| β-strand | 37-41 | 5 | 3 |
| β-strand | 44-53 | 10 | 3 |
| β-strand | 62-68 | 7 | 3 |
| α-helix | 69-81 | 13 | |
| α-helix | 83-85 | 3 | |
| α-helix | 89-97 | 9 | |
| α-helix | 100-109 | 10 | |
| α-helix | 118-152 | 35 | |
| α-helix | 156-158 | 3 | |
| α-helix | 160-167 | 8 | |
Chain G: 6 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 32-34 | 3 | 4 |
| β-strand | 37-40 | 4 | 4 |
| β-strand | 45-52 | 8 | 4 |
| β-strand | 62-68 | 7 | 4 |
| α-helix | 69-81 | 13 | |
| α-helix | 91-97 | 7 | |
| α-helix | 100-111 | 12 | |
| α-helix | 118-152 | 35 | |
| α-helix | 154-157 | 4 | |
| α-helix | 160-167 | 8 | |
Chain H: 1 helix, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 113-117 | 5 | 4 |
| α-helix | 118-120 | 3 | |
| β-strand | 126-130 | 5 | 4 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Sorting nexin-5 | A, C, E, G | protein | 152 | Homo sapiens | Q9Y5X3 (AlphaFold model) |
| IncE | B, D, F, H | protein | 23 | Chlamydia trachomatis | B7SCI5 (AlphaFold model) |
Sequence of entity 1 (A, C, E, G), FASTA
>5TGH_1 Sorting nexin-5 (chains A, C, E, G)
GSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLI
ETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTV
SSHEVFLQRLSSHPVLSKDRNFHVFLEYDQPA
Sequence of entity 2 (B, D, F, H), FASTA
>5TGH_2 IncE (chains B, D, F, H)
NGPAVQFFKGKNGSADQVILVTQ
Primary citation
Structural basis for the hijacking of endosomal sorting nexin proteins byChlamydia trachomatis. Paul, B., Kim, H.S., Kerr, M.C. et al. Elife (2017) 6. DOI 10.7554/eLife.22311 · PubMed
Other PDB entries of the same protein (UniProt Q9Y5X3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5WY2 1.9 Å, Human Snx5 PX domain in complex with Chlamydia IncE C terminus
- 5TGI 1.98 Å, Structure of the SNX5 PX domain in complex with chlamydial protein IncE in space group…
- 6N5X 2.05 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
- 6N5Y 2.26 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
- 9IAE 2.3 Å, Structure of a Chimeric Protein Composed of the SNX5 PX Domain and the N-Terminal Region…
- 9IGY 2.3 Å, Structure of a Chimeric Protein Composed of the SNX5 PhoX Domain and the N-terminal…
- 1SYS 2.4 Å, Crystal structure of HLA, B*4403, and peptide EEPTVIKKY
- 6N5Z 2.45 Å, Crystal structure of the SNX5 PX domain in complex with the Sema4C
- 8A1G 2.5 Å, Structure of the SNX1-SNX5 complex
- 5TGJ 2.6 Å, Structure of the SNX5 PX domain in complex with chlamydial protein IncE in space group I2
- 8ABQ 2.81 Å, Structure of the SNX1-SNX5 complex, Pt derivative
- 8AFZ 10.0 Å, Architecture of the ESCPE-1 membrane coat
Browse structure collections
About this viewer
MolViewer shows 5TGH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.