5TGI: SNX5 PX domain

Structure of the SNX5 PX domain in complex with chlamydial protein IncE in space group P212121. Determined by X-ray diffraction at 1.98 Å resolution. Released 28 Jun 2017.

Method: X-ray diffraction
Resolution: 1.98 Å
Organisms: Homo sapiens, Chlamydia trachomatis
Chains: 4
Atoms: 2,855
Mol. weight: 39.33 kDa
Released: 28 Jun 2017

Explore 5TGI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TGI contains 14 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	31-34	4	1
β-strand	37-40	4	1
β-strand	45-53	9	1
β-strand	62-68	7	1
α-helix	69-80	12
α-helix	83-85	3
α-helix	91-97	7
α-helix	100-111	12
α-helix	119-151	33
α-helix	156-158	3
α-helix	160-167	8

Chain B: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	31-34	4	2
β-strand	37-41	5	2
β-strand	44-53	10	2
β-strand	62-68	7	2
α-helix	69-80	12
α-helix	83-85	3
α-helix	91-97	7
α-helix	100-109	10
α-helix	122-151	30
α-helix	156-158	3
α-helix	160-167	8

Chain C: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	114-117	4	1
β-strand	126-129	4	1

Chain D: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	113-117	5	2
β-strand	126-129	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-5	A, B	protein	152	Homo sapiens	Q9Y5X3 (AlphaFold model)
IncE	C, D	protein	22	Chlamydia trachomatis	B7SCI5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5TGI_1 Sorting nexin-5 (chains A, B)
GSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLI
ETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTV
SSHEVFLQRLSSHPVLSKDRNFHVFLEYDQPA

Sequence of entity 2 (C, D), FASTA

>5TGI_2 IncE (chains C, D)
GPAVQFFKGKNGSADQVILVTQ

Primary citation

Structure of the SNX5 PX domain in complex with chlamydial protein IncE. Collins, B., Paul, B. To be published.

Other PDB entries of the same protein (UniProt Q9Y5X3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WY2 1.9 Å, Human Snx5 PX domain in complex with Chlamydia IncE C terminus
6N5X 2.05 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
6N5Y 2.26 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
9IAE 2.3 Å, Structure of a Chimeric Protein Composed of the SNX5 PX Domain and the N-Terminal Region…
9IGY 2.3 Å, Structure of a Chimeric Protein Composed of the SNX5 PhoX Domain and the N-terminal…
1SYS 2.4 Å, Crystal structure of HLA, B*4403, and peptide EEPTVIKKY
6N5Z 2.45 Å, Crystal structure of the SNX5 PX domain in complex with the Sema4C
8A1G 2.5 Å, Structure of the SNX1-SNX5 complex
5TGJ 2.6 Å, Structure of the SNX5 PX domain in complex with chlamydial protein IncE in space group I2
5TGH 2.8 Å, Structure of the SNX5 PX domain in complex with chlamydial protein IncE in space group P32
8ABQ 2.81 Å, Structure of the SNX1-SNX5 complex, Pt derivative
8AFZ 10.0 Å, Architecture of the ESCPE-1 membrane coat

Browse structure collections

About this viewer

MolViewer shows 5TGI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.