9HM2: A swapped dimeric form of ZO1/TJP1 PDZ2

A swapped dimeric form of ZO1/TJP1 PDZ2 in complex with the C-terminal peptide from protein E of SARS-CoV-2. Determined by X-ray diffraction at 1.72 Å resolution. Released 22 Oct 2025.

Method: X-ray diffraction
Resolution: 1.72 Å
Organisms: Homo sapiens, Severe acute respiratory syndrome coronavirus 2
Chains: 4
Atoms: 1,492
Mol. weight: 21.99 kDa
Released: 22 Oct 2025

Explore 9HM2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HM2 contains 8 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	185-190	6	1
β-strand	200-211	12	1
α-helix	216-219	4
α-helix	227	1
β-strand	228-232	5	1
β-strand	235-236	2	1
α-helix	242-251	10
β-strand	255-261	7	1
α-helix	263-265	3

Chain B: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	185-190	6	1
β-strand	200-211	12	1
α-helix	216-220	5
β-strand	228-232	5	1
β-strand	235-236	2	1
α-helix	242-250	9
β-strand	255-261	7	1

Chains C and D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	5-6	2
β-strand	7-8	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tight junction protein ZO-1	A, B	protein	84	Homo sapiens	Q07157 (AlphaFold model)
Envelope small membrane protein	C, D	protein	12	Severe acute respiratory syndrome coronavirus 2	P0DTC4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9HM2_1 Tight junction protein ZO-1 (chains A, B)
GSKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENMSLT
DAKTLIERSKGKLKMVVQRDWNSS

Sequence of entity 2 (C, D), FASTA

>9HM2_2 Envelope small membrane protein (chains C, D)
NLNSSRVPDLLV

Primary citation

HTRF-based identification of small molecules targeting SARS-CoV-2 E protein interaction with ZO-1 PDZ2. Alvarez, F., Larrous, F., Mechaly, A. et al. Sci Rep (2025) 16:2034-2034. DOI 10.1038/s41598-025-31755-y · PubMed

Other PDB entries of the same protein (UniProt Q07157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Q2Q 1.45 Å, ZO1 PDZ3 in Complex with a Phage-Derived Peptide
2H2B 1.6 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTYL)
2RCZ 1.7 Å, Structure of the second PDZ domain of ZO-1
4YYX 1.79 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin2 C-terminal…
4OEO 1.9 Å, High resolution crystal structure of the unliganded ZO-1 PDZ1 domain
3TSV 1.99 Å, crystal structure of the third PDZ domain of the human ZO-1 MAGUK protein
2H2C 2.0 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTWV)
4OEP 2.35 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin1 C-terminal…
3CYY 2.4 Å, The crystal structure of ZO-1 PDZ2 in complex with the Cx43 peptide
3TSZ 2.5 Å, crystal structure of PDZ3-SH3-GUK core module from human ZO-1 in complex with 12mer…
3LH5 2.6 Å, Crystal Structure of the SH3-Guanylate kinase core domain of ZO-1
3SHU 2.75 Å, Crystal structure of ZO-1 PDZ3

Browse structure collections

About this viewer

MolViewer shows 9HM2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.