9LXG: Filamin A repeat 21

Filamin A repeat 21 in complex with LARP4 Ala269-Asn281 peptide. Determined by X-ray diffraction at 2.46 Å resolution. Released 5 Mar 2025.

Method: X-ray diffraction
Resolution: 2.46 Å
Organism: Esselenichthys carli
Chains: 2
Atoms: 812
Mol. weight: 11.68 kDa
Released: 5 Mar 2025

Explore 9LXG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LXG contains 4 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
β-strand	7-9	3	1
α-helix	11-13	3
β-strand	16-17	2	2
β-strand	22-27	6	1
β-strand	34-42	9	2
β-strand	47-52	6	1
β-strand	57-63	7	1
β-strand	68-76	9	2
β-strand	79-80	2	2
α-helix	81	1
α-helix	84	1
β-strand	86-91	6	2

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	103-111	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-A	A	protein	101	Esselenichthys carli	P21333 (AlphaFold model)
La-related protein 4	B	protein	13	Esselenichthys carli	Q8BWW4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9LXG_1 Filamin-A (chains A)
MGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCG
VAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGGGGGG

Sequence of entity 2 (B), FASTA

>9LXG_2 La-related protein 4 (chains B)
ARIKAINTFFAKN

Primary citation

Structural Basis of the LARP4-Filamin A Interaction and Competition with Integrin beta 7 Tails. Mao, Z., Ding, Y., Liu, Y. et al. J Mol Biol (2025) 437:169262-169262. DOI 10.1016/j.jmb.2025.169262 · PubMed

Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CNK 1.65 Å, Crystal Structure of the dimerization domain of human filamin A
4M9P 1.72 Å, Crystal structure of the human filamin A Ig-like domains 3-5
7SC4 1.85 Å, filamin complex-1
2W0P 1.9 Å, Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide
4P3W 2.0 Å, Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin…
2BRQ 2.1 Å, Crystal structure of the filamin A repeat 21 complexed with the integrin beta7…
2JF1 2.2 Å, Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2…
9LWX 2.29 Å, Crystal structure of the Filamin A repeat 21
3HOC 2.3 Å, Structure of the actin-binding domain of human filamin A mutant E254K
3HOP 2.3 Å, Structure of the actin-binding domain of human filamin A
6EW1 2.31 Å, Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q
2BP3 2.32 Å, Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex

Browse structure collections

About this viewer

MolViewer shows 9LXG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.