1EQQ: Single stranded DNA binding protein

Single stranded DNA binding protein and ssDNA complex. Determined by X-ray diffraction at 3.2 Å resolution. Released 23 Sept 2003.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Escherichia coli
Chains: 6
Atoms: 3,737
Mol. weight: 77.8 kDa
Released: 23 Sept 2003

Explore 1EQQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EQQ contains 4 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5-14	10	1
β-strand	22-23	2	2
β-strand	27-28	2	2
β-strand	33-38	6	1
β-strand	51-56	6	1
β-strand	57-59	3	3
α-helix	61-70	10
β-strand	76-79	4	1
β-strand	82-89	8	3
β-strand	94-102	9	3
β-strand	109-110	2	1

Chain B: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	205-214	10	1
β-strand	220-221	2	4
β-strand	229-230	2	4
β-strand	233-235	3	1
β-strand	238-241	4	5
β-strand	248-251	4	5
β-strand	254-256	3	1
β-strand	257-258	2	6
β-strand	259-260	2	4
α-helix	261-270	10
β-strand	276-279	4	1
β-strand	282-289	8	6
β-strand	294-301	8	6
β-strand	309-310	2	1

Chain C: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	405-414	10	7
β-strand	419-422	4	8
β-strand	428-431	4	8
β-strand	433-435	3	7
β-strand	438-439	2	9
β-strand	450-451	2	9
β-strand	454-456	3	7
β-strand	457-458	2	10
β-strand	459-460	2	8
α-helix	461-470	10
β-strand	476-479	4	7
β-strand	482-489	8	10
β-strand	494-501	8	10
β-strand	509-510	2	7

Chain D: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	605-614	10	7
β-strand	622	1	11
β-strand	628	1	11
β-strand	633-635	3	7
β-strand	638-640	3	12
β-strand	649-651	3	12
β-strand	654-656	3	7
β-strand	657-658	2	13
α-helix	661-670	10
β-strand	676-679	4	7
β-strand	682-689	8	13
β-strand	694-701	8	13
β-strand	709-710	2	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-R((5MU)P(5MU)P*(5MU))-3'	M, N	RNA	3
Single stranded DNA binding protein	A, B, C, D	protein	178	Escherichia coli	P0AGE0 (AlphaFold model)

Sequence of entity 1 (M, N), FASTA

>1EQQ_1 5'-R(*(5MU)P*(5MU)P*(5MU))-3' (chains M, N)
UUU

Sequence of entity 2 (A, B, C, D), FASTA

>1EQQ_2 SINGLE STRANDED DNA BINDING PROTEIN (chains A, B, C, D)
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVL
FGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGG
APAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF

Primary citation

Roles of functional loops and the C-terminal segment of a single-stranded DNA binding protein elucidated by X-Ray structure analysis. Matsumoto, T., Morimoto, Y., Shibata, N. et al. J Biochem (2000) 127:329-335. PubMed

Other PDB entries of the same protein (UniProt P0AGE0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UF7 1.2 Å, Co-crystal structure of Escherichia coli uracil-DNA glycosylase and a C-terminal…
8TGC 1.48 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 4
8TG8 1.58 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 3
8TG7 1.77 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 2
3SXU 1.85 Å, Structure of the E. coli SSB-DNA polymerase III interface
4Z0U 2.0 Å, RNase HI/SSB-Ct complex
1QVC 2.2 Å, Crystal structure analysis of single stranded DNA binding protein (SSB) from e.coli
4MZ9 2.2 Å, Revised structure of E. coli SSB
3Q8D 2.3 Å, E. coli RecO complex with SSB C-terminus
3C94 2.7 Å, ExoI/SSB-Ct complex
1EYG 2.8 Å, Crystal structure of chymotryptic fragment of E. coli ssb bound to two 35-mer single…
1KAW 2.9 Å, Structure of single stranded DNA binding protein (SSB)

Browse structure collections

About this viewer

MolViewer shows 1EQQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.