4MZ9: Revised structure of E. coli SSB

Name: PDB 4MZ9: Revised structure of E. coli SSB
Published: 2013-12-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: dna binding protein

Revised structure of E. coli SSB. Determined by X-ray diffraction at 2.2 Å resolution. Released 18 Dec 2013.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Escherichia coli
Chains: 4
Atoms: 3,691
Mol. weight: 75.97 kDa
Released: 18 Dec 2013

Explore 4MZ9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MZ9 contains 4 α-helices and 30 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	5-14	10	1
β-strand	19-21	3	1
β-strand	29-38	10	1
β-strand	51-60	10	1
α-helix	62-70	9
β-strand	76-87	12	1
β-strand	97-103	7	1
β-strand	108-111	4	1

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	5-14	10	1
β-strand	19-21	3	1
β-strand	29-36	8	1
β-strand	39	1	2
β-strand	50	1	2
β-strand	53-60	8	1
α-helix	61-70	10
β-strand	76-89	14	1
β-strand	95-103	9	1
β-strand	108-111	4	1

Chain C: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	5-14	10	3
β-strand	19-23	5	3
β-strand	27-40	14	3
β-strand	49-60	12	3
α-helix	61-70	10
β-strand	76-89	14	3
β-strand	95-103	9	3
β-strand	108-111	4	3

Chain D: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	5-14	10	3
β-strand	19-22	4	3
β-strand	28-39	12	3
β-strand	50-60	11	3
α-helix	61-70	10
β-strand	76-89	14	3
β-strand	95-103	9	3
β-strand	108-111	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Single-stranded DNA-binding protein	A, B, C, D	protein	178	Escherichia coli	P0AGE0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4MZ9_1 Single-stranded DNA-binding protein (chains A, B, C, D)
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVL
FGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGG
APAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF

Primary citation

Intramolecular binding mode of the C-terminus of Escherichia coli single-stranded DNA binding protein determined by nuclear magnetic resonance spectroscopy. Shishmarev, D., Wang, Y., Mason, C.E. et al. Nucleic Acids Res (2014) 42:2750-2757. DOI 10.1093/nar/gkt1238 · PubMed

Other PDB entries of the same protein (UniProt P0AGE0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UF7 1.2 Å, Co-crystal structure of Escherichia coli uracil-DNA glycosylase and a C-terminal…
8TGC 1.48 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 4
8TG8 1.58 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 3
8TG7 1.77 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 2
3SXU 1.85 Å, Structure of the E. coli SSB-DNA polymerase III interface
4Z0U 2.0 Å, RNase HI/SSB-Ct complex
1QVC 2.2 Å, Crystal structure analysis of single stranded DNA binding protein (SSB) from e.coli
3Q8D 2.3 Å, E. coli RecO complex with SSB C-terminus
3C94 2.7 Å, ExoI/SSB-Ct complex
1EYG 2.8 Å, Crystal structure of chymotryptic fragment of E. coli ssb bound to two 35-mer single…
1KAW 2.9 Å, Structure of single stranded DNA binding protein (SSB)
1EQQ 3.2 Å, Single stranded DNA binding protein and ssDNA complex

Browse structure collections

About this viewer

MolViewer shows 4MZ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.