1EYG: Chymotryptic fragment of E. coli ssb

Crystal structure of chymotryptic fragment of E. coli ssb bound to two 35-mer single strand DNAS. Determined by X-ray diffraction at 2.8 Å resolution. Released 1 Aug 2000.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Escherichia coli
Chains: 6
Atoms: 4,244
Mol. weight: 71.78 kDa
Released: 1 Aug 2000

Explore 1EYG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EYG contains 4 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1005-1014	10	1
β-strand	1019-1021	3	1
β-strand	1029-1037	9	1
β-strand	1052-1060	9	1
α-helix	1061-1070	10
β-strand	1076-1089	14	1
β-strand	1095-1103	9	1
β-strand	1108-1111	4	1

Chain B: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2005-2014	10	1
β-strand	2019-2021	3	1
β-strand	2029-2038	10	1
β-strand	2051-2060	10	1
α-helix	2061-2070	10
β-strand	2076-2089	14	1
β-strand	2095-2103	9	1
β-strand	2108-2111	4	1

Chain C: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	3005-3014	10	2
β-strand	3019-3021	3	2
β-strand	3029-3038	10	2
β-strand	3051-3060	10	2
α-helix	3061-3070	10
β-strand	3076-3089	14	2
β-strand	3095-3103	9	2
β-strand	3108-3111	4	2

Chain D: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4005-4014	10	2
β-strand	4019-4021	3	2
β-strand	4029-4037	9	2
β-strand	4052-4060	9	2
α-helix	4061-4070	10
β-strand	4076-4088	13	2
β-strand	4096-4102	7	2
β-strand	4108-4111	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Single stranded 28-mer of d(c)	Q, R	DNA	35
Single-strand DNA-binding protein	A, B, C, D	protein	116	Escherichia coli	P0AGE0 (AlphaFold model)

Sequence of entity 1 (Q, R), FASTA

>1EYG_1 SINGLE STRANDED 28-MER OF D(C) (chains Q, R)
CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC

Sequence of entity 2 (A, B, C, D), FASTA

>1EYG_2 SINGLE-STRAND DNA-BINDING PROTEIN (chains A, B, C, D)
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVL
FGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGR

Primary citation

Structure of the DNA binding domain of E. coli SSB bound to ssDNA. Raghunathan, S., Kozlov, A.G., Lohman, T.M. et al. Nat Struct Biol (2000) 7:648-652. DOI 10.1038/77943 · PubMed

Other PDB entries of the same protein (UniProt P0AGE0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UF7 1.2 Å, Co-crystal structure of Escherichia coli uracil-DNA glycosylase and a C-terminal…
8TGC 1.48 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 4
8TG8 1.58 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 3
8TG7 1.77 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 2
3SXU 1.85 Å, Structure of the E. coli SSB-DNA polymerase III interface
4Z0U 2.0 Å, RNase HI/SSB-Ct complex
1QVC 2.2 Å, Crystal structure analysis of single stranded DNA binding protein (SSB) from e.coli
4MZ9 2.2 Å, Revised structure of E. coli SSB
3Q8D 2.3 Å, E. coli RecO complex with SSB C-terminus
3C94 2.7 Å, ExoI/SSB-Ct complex
1KAW 2.9 Å, Structure of single stranded DNA binding protein (SSB)
1EQQ 3.2 Å, Single stranded DNA binding protein and ssDNA complex

Browse structure collections

About this viewer

MolViewer shows 1EYG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.