1QVC: Single stranded DNA binding protein monomer

Name: PDB 1QVC: Crystal structure analysis of single stranded DNA binding protein (SSB) from e.coli
Published: 2000-06-05
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: dna binding protein

Crystal structure analysis of single stranded DNA binding protein (SSB) from e.coli. Determined by X-ray diffraction at 2.2 Å resolution. Released 5 Jun 2000.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Escherichia coli
Chains: 4
Atoms: 4,748
Mol. weight: 61.89 kDa
Released: 5 Jun 2000

Explore 1QVC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QVC contains 4 α-helices and 30 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	5-14	10	1
β-strand	19-21	3	1
β-strand	29-36	8	1
β-strand	53-60	8	1
α-helix	62-70	9
β-strand	76-88	13	1
β-strand	95-102	8	1
β-strand	107-110	4	1

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	205-214	10	1
β-strand	219-223	5	1
β-strand	227-236	10	1
β-strand	240	1	2
β-strand	249	1	2
β-strand	253-260	8	1
α-helix	261-270	10
β-strand	276-289	14	1
β-strand	294-302	9	1
β-strand	307-310	4	1

Chain C: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	405-414	10	3
β-strand	419-421	3	3
β-strand	429-440	12	3
β-strand	449-460	12	3
α-helix	461-470	10
β-strand	476-489	14	3
β-strand	494-502	9	3
β-strand	507-510	4	3

Chain D: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	605-614	10	3
β-strand	619-622	4	3
β-strand	628-640	13	3
β-strand	649-660	12	3
α-helix	662-670	9
β-strand	676-688	13	3
β-strand	695-702	8	3
β-strand	707-710	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Single stranded DNA binding protein monomer	A, B, C, D	protein	145	Escherichia coli	P0AGE0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1QVC_1 SINGLE STRANDED DNA BINDING PROTEIN MONOMER (chains A, B, C, D)
ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLF
GKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGA
PAGGNIGGGQPQGGWGQPQQPQGGN

Primary citation

Roles of functional loops and the C-terminal segment of a single-stranded DNA binding protein elucidated by X-Ray structure analysis. Matsumoto, T., Morimoto, Y., Shibata, N. et al. J Biochem (2000) 127:329-335. PubMed

Other PDB entries of the same protein (UniProt P0AGE0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UF7 1.2 Å, Co-crystal structure of Escherichia coli uracil-DNA glycosylase and a C-terminal…
8TGC 1.48 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 4
8TG8 1.58 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 3
8TG7 1.77 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 2
3SXU 1.85 Å, Structure of the E. coli SSB-DNA polymerase III interface
4Z0U 2.0 Å, RNase HI/SSB-Ct complex
4MZ9 2.2 Å, Revised structure of E. coli SSB
3Q8D 2.3 Å, E. coli RecO complex with SSB C-terminus
3C94 2.7 Å, ExoI/SSB-Ct complex
1EYG 2.8 Å, Crystal structure of chymotryptic fragment of E. coli ssb bound to two 35-mer single…
1KAW 2.9 Å, Structure of single stranded DNA binding protein (SSB)
1EQQ 3.2 Å, Single stranded DNA binding protein and ssDNA complex

Browse structure collections

About this viewer

MolViewer shows 1QVC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.