1KAW: Single stranded DNA binding protein

Name: PDB 1KAW: Structure of single stranded DNA binding protein (SSB)
Published: 1997-12-31
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: dna binding protein

Structure of single stranded DNA binding protein (SSB). Determined by X-ray diffraction at 2.9 Å resolution. Released 31 Dec 1997.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Escherichia coli
Chains: 4
Atoms: 3,067
Mol. weight: 57.92 kDa
Released: 31 Dec 1997

Explore 1KAW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KAW contains 4 α-helices and 26 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	5-14	10	1
β-strand	30-36	7	1
β-strand	53-59	7	1
α-helix	61-70	10
β-strand	76-87	12	1
β-strand	88	1	2
β-strand	97-103	7	1
β-strand	108-111	4	1

Chains B and D: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	5-14	10	1
β-strand	30-36	7	1
β-strand	53-59	7	1
α-helix	61-70	10
β-strand	76-87	12	1
β-strand	97-103	7	1
β-strand	108-111	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Single-stranded DNA binding protein	A, B, C, D	protein	135	Escherichia coli	P0AGE0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1KAW_1 SINGLE-STRANDED DNA BINDING PROTEIN (chains A, B, C, D)
ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLF
GKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGA
PAGGNIGGGQPQGGW

Primary citation

Crystal structure of the homo-tetrameric DNA binding domain of Escherichia coli single-stranded DNA-binding protein determined by multiwavelength x-ray diffraction on the selenomethionyl protein at 2.9-A resolution. Raghunathan, S., Ricard, C.S., Lohman, T.M. et al. Proc Natl Acad Sci U S A (1997) 94:6652-6657. DOI 10.1073/pnas.94.13.6652 · PubMed

Other PDB entries of the same protein (UniProt P0AGE0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UF7 1.2 Å, Co-crystal structure of Escherichia coli uracil-DNA glycosylase and a C-terminal…
8TGC 1.48 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 4
8TG8 1.58 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 3
8TG7 1.77 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 2
3SXU 1.85 Å, Structure of the E. coli SSB-DNA polymerase III interface
4Z0U 2.0 Å, RNase HI/SSB-Ct complex
1QVC 2.2 Å, Crystal structure analysis of single stranded DNA binding protein (SSB) from e.coli
4MZ9 2.2 Å, Revised structure of E. coli SSB
3Q8D 2.3 Å, E. coli RecO complex with SSB C-terminus
3C94 2.7 Å, ExoI/SSB-Ct complex
1EYG 2.8 Å, Crystal structure of chymotryptic fragment of E. coli ssb bound to two 35-mer single…
1EQQ 3.2 Å, Single stranded DNA binding protein and ssDNA complex

Browse structure collections

About this viewer

MolViewer shows 1KAW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.