1H8B: Alpha-actinin 2, skeletal muscle isoform

EF-hands 3,4 from alpha-actinin / Z-repeat 7 from titin. Determined by solution NMR. Released 30 Aug 2001.

Method: Solution NMR
Organisms: HOMO SAPIENS, ORYCTOLAGUS CUNICULUS
Chains: 2
Atoms: 726
Mol. weight: 13.74 kDa
Released: 30 Aug 2001

Explore 1H8B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1H8B contains 5 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	7-17	11
β-strand	24	1	1
α-helix	26-32	7
α-helix	35-44	10
β-strand	58	1	1
α-helix	60-67	8

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-24	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-actinin 2, skeletal muscle isoform	A	protein	75	HOMO SAPIENS	P35609 (AlphaFold model)
Titin	B	protein	53	ORYCTOLAGUS CUNICULUS	O97791

Sequence of entity 1 (A), FASTA

>1H8B_1 ALPHA-ACTININ 2, SKELETAL MUSCLE ISOFORM (chains A)
GAMADTDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGAL
DYAAFSSALYGESDL

Sequence of entity 2 (B), FASTA

>1H8B_2 TITIN (chains B)
GAMGKVGVGKKAEAVATVVAAVDQARVREPREPGLPEDSYAQQTTLEYGYKEH

Primary citation

Ca2+-Independent Binding of an EF-Hand Domain to a Novel Motif in the Alpha-Actinin-Titin Complex. Atkinson, R.A., Joseph, C., Kelly, G. et al. Nat Struct Biol (2001) 8:853. DOI 10.1038/NSB1001-853 · PubMed

Other PDB entries of the same protein (UniProt P35609 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SWT 1.2 Å, Affimer9 co-crystalised with the CH domains of alpha actinin 2.
6TS3 1.28 Å, EF-hands 3 and 4 of alpha-actinin in complex with CaMKII regulatory segment
7B56 1.45 Å, Crystal structure of CaMKII-actinin complex bound to AMPPNP
7B55 1.6 Å, Crystal structure of CaMKII-actinin complex bound to MES
5A37 1.88 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
5A38 1.9 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
7B57 1.95 Å, Crystal structure of CaMKII-actinin complex bound to ADP
5A36 2.0 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
5A4B 2.01 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
1QUU 2.5 Å, Crystal structure of two central spectrin-like repeats from alpha-actinin
7A8T 2.69 Å, Crystal structure of sarcomeric protein FATZ-1 (mini-FATZ-1 construct) in complex with…
1HCI 2.8 Å, Crystal structure of the rod domain of alpha-actinin

Browse structure collections

About this viewer

MolViewer shows 1H8B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.