6SWT: Alpha-actinin-2

Affimer9 co-crystalised with the CH domains of alpha actinin 2. Determined by X-ray diffraction at 1.2 Å resolution. Released 7 Oct 2020.

Method: X-ray diffraction
Resolution: 1.2 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 2,833
Mol. weight: 39.97 kDa
Released: 7 Oct 2020

Explore 6SWT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SWT contains 16 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	32-52	21
α-helix	53-55	3
α-helix	70-80	11
α-helix	83-88	6
α-helix	93-109	17
α-helix	119-123	5
α-helix	127-138	12
α-helix	139-143	5
β-strand	147-148	2	1
β-strand	151-152	2	1
α-helix	153-165	13
α-helix	178-180	3
α-helix	184-193	10
β-strand	198	1	2
α-helix	200-202	3
α-helix	208-222	15
α-helix	231-236	6
α-helix	242-256	15

Chain B: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
α-helix	6-23	18
β-strand	28-41	14	3
β-strand	46-58	13	3
β-strand	61-73	13	3
β-strand	77	1	2
β-strand	83-91	9	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-actinin-2	A	protein	254	Homo sapiens	P35609 (AlphaFold model)
Affimer 9	B	protein	91	synthetic construct

Sequence of entity 1 (A), FASTA

>6SWT_1 Alpha-actinin-2 (chains A)
GPYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLL
EVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWT
IILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPD
LIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAF
AGAEQAETAANRIC

Sequence of entity 2 (B), FASTA

>6SWT_2 Affimer 9 (chains B)
SENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQHQFHMSWTWTMYYLTLEAKDGGK
KKLYEAKVWVKHHPAYIADINFKELQEFKPV

Primary citation

Nanoscale Pattern Extraction from Relative Positions of Sparse 3D Localizations. Curd, A.P., Leng, J., Hughes, R.E. et al. Nano Lett (2021) 21:1213-1220. DOI 10.1021/acs.nanolett.0c03332 · PubMed

Other PDB entries of the same protein (UniProt P35609 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TS3 1.28 Å, EF-hands 3 and 4 of alpha-actinin in complex with CaMKII regulatory segment
7B56 1.45 Å, Crystal structure of CaMKII-actinin complex bound to AMPPNP
7B55 1.6 Å, Crystal structure of CaMKII-actinin complex bound to MES
5A37 1.88 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
5A38 1.9 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
7B57 1.95 Å, Crystal structure of CaMKII-actinin complex bound to ADP
5A36 2.0 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
5A4B 2.01 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
1QUU 2.5 Å, Crystal structure of two central spectrin-like repeats from alpha-actinin
7A8T 2.69 Å, Crystal structure of sarcomeric protein FATZ-1 (mini-FATZ-1 construct) in complex with…
1HCI 2.8 Å, Crystal structure of the rod domain of alpha-actinin
7ANK 3.2 Å, Crystal structure of sarcomeric protein FATZ-1 (d91-FATZ-1 construct) in complex with…

Browse structure collections

About this viewer

MolViewer shows 6SWT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.