7A8T: Sarcomeric protein FATZ-1

Crystal structure of sarcomeric protein FATZ-1 (mini-FATZ-1 construct) in complex with rod domain of alpha-actinin-2. Determined by X-ray diffraction at 2.69 Å resolution. Released 30 Jun 2021.

Method: X-ray diffraction
Resolution: 2.69 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,309
Mol. weight: 66.67 kDa
Released: 30 Jun 2021

Explore 7A8T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7A8T contains 20 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	274-277	4
α-helix	280-304	25
α-helix	313-325	13
α-helix	326-330	5
α-helix	331-354	24
α-helix	357-360	4
α-helix	368-383	16
α-helix	386-417	32
α-helix	420-425	6
α-helix	428-431	4
α-helix	434-453	20
α-helix	455-470	16
α-helix	476-538	63
α-helix	548-588	41
α-helix	606-665	60
α-helix	671-704	34
α-helix	717-745	29

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	187-191	5
α-helix	225-227	3
α-helix	231-238	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-actinin-2	A	protein	476	Homo sapiens	P35609 (AlphaFold model)
Myozenin-1	B	protein	92	Homo sapiens	Q9NP98 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7A8T_1 Alpha-actinin-2 (chains A)
GSSAVNQENERLMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKH
KPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLL
NEIRRLERLEHLAEKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESD
LAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALERMEKL
LETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADG
ERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELA
RQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKN
NIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRD

Sequence of entity 2 (B), FASTA

>7A8T_2 Myozenin-1 (chains B)
GPAMKHITVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPYGGY
EKASKRMTFQMPKFDLGPLLSEPLVLYNQNLS

Primary citation

Order from disorder in the sarcomere: FATZ forms a fuzzy but tight complex and phase-separated condensates with alpha-actinin. Sponga, A., Arolas, J.L., Schwarz, T.C. et al. Sci Adv (2021) 7. DOI 10.1126/sciadv.abg7653 · PubMed

Other PDB entries of the same protein (UniProt P35609 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SWT 1.2 Å, Affimer9 co-crystalised with the CH domains of alpha actinin 2.
6TS3 1.28 Å, EF-hands 3 and 4 of alpha-actinin in complex with CaMKII regulatory segment
7B56 1.45 Å, Crystal structure of CaMKII-actinin complex bound to AMPPNP
7B55 1.6 Å, Crystal structure of CaMKII-actinin complex bound to MES
5A37 1.88 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
5A38 1.9 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
7B57 1.95 Å, Crystal structure of CaMKII-actinin complex bound to ADP
5A36 2.0 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
5A4B 2.01 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
1QUU 2.5 Å, Crystal structure of two central spectrin-like repeats from alpha-actinin
1HCI 2.8 Å, Crystal structure of the rod domain of alpha-actinin
7ANK 3.2 Å, Crystal structure of sarcomeric protein FATZ-1 (d91-FATZ-1 construct) in complex with…

Browse structure collections

About this viewer

MolViewer shows 7A8T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.