1HCI: Rod domain of alpha-actinin

Crystal structure of the rod domain of alpha-actinin. Determined by X-ray diffraction at 2.8 Å resolution. Released 27 Jun 2001.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 7,900
Mol. weight: 112.42 kDa
Released: 27 Jun 2001

Explore 1HCI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HCI contains 34 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	275-294	20
α-helix	296-303	8
α-helix	318-325	8
α-helix	326-330	5
α-helix	331-340	10
α-helix	344-347	4
α-helix	364-366	3
α-helix	371-382	12
α-helix	385-417	33
α-helix	420-425	6
α-helix	428-430	3
α-helix	434-470	37
α-helix	476-538	63
α-helix	548-587	40
α-helix	604-661	58
α-helix	672-704	33
α-helix	716-741	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-actinin 2	A, B	protein	476	HOMO SAPIENS	P35609 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1HCI_1 ALPHA-ACTININ 2 (chains A, B)
GSSAVNQENERLMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKH
KPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLL
NEIRRLERLEHLAEKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESD
LAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALERMEKL
LETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADG
ERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELA
RQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKN
NIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRD

Primary citation

Crystal Structure of the Alpha-Actinin Rod Reveals an Extensive Torsional Twist. Ylanne, J., Scheffzek, K., Young, P. et al. Structure (2001) 9:597. DOI 10.1016/S0969-2126(01)00619-0 · PubMed

Other PDB entries of the same protein (UniProt P35609 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SWT 1.2 Å, Affimer9 co-crystalised with the CH domains of alpha actinin 2.
6TS3 1.28 Å, EF-hands 3 and 4 of alpha-actinin in complex with CaMKII regulatory segment
7B56 1.45 Å, Crystal structure of CaMKII-actinin complex bound to AMPPNP
7B55 1.6 Å, Crystal structure of CaMKII-actinin complex bound to MES
5A37 1.88 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
5A38 1.9 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
7B57 1.95 Å, Crystal structure of CaMKII-actinin complex bound to ADP
5A36 2.0 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
5A4B 2.01 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
1QUU 2.5 Å, Crystal structure of two central spectrin-like repeats from alpha-actinin
7A8T 2.69 Å, Crystal structure of sarcomeric protein FATZ-1 (mini-FATZ-1 construct) in complex with…
7ANK 3.2 Å, Crystal structure of sarcomeric protein FATZ-1 (d91-FATZ-1 construct) in complex with…

Browse structure collections

About this viewer

MolViewer shows 1HCI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.