1QUU: Human skeletal muscle alpha-actinin 2

Crystal structure of two central spectrin-like repeats from alpha-actinin. Determined by X-ray diffraction at 2.5 Å resolution. Released 20 Aug 1999.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,185
Mol. weight: 29.28 kDa
Released: 20 Aug 1999

Explore 1QUU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QUU contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	6-29	24
α-helix	33-38	6
α-helix	47-83	37
α-helix	89-149	61
α-helix	164-175	12
α-helix	177-201	25
α-helix	217-245	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human skeletal muscle alpha-actinin 2	A	protein	250	Homo sapiens	P35609 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QUU_1 HUMAN SKELETAL MUSCLE ALPHA-ACTININ 2 (chains A)
GSSNEIRRLERLEHLAEKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAF
ESDLAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALERM
EKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPE
ADGERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQE
ELARQHANER

Primary citation

Structure of the alpha-actinin rod: molecular basis for cross-linking of actin filaments. Djinovic-Carugo, K., Young, P., Gautel, M. et al. Cell (1999) 98:537-546. DOI 10.1016/S0092-8674(00)81981-9 · PubMed

Other PDB entries of the same protein (UniProt P35609 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SWT 1.2 Å, Affimer9 co-crystalised with the CH domains of alpha actinin 2.
6TS3 1.28 Å, EF-hands 3 and 4 of alpha-actinin in complex with CaMKII regulatory segment
7B56 1.45 Å, Crystal structure of CaMKII-actinin complex bound to AMPPNP
7B55 1.6 Å, Crystal structure of CaMKII-actinin complex bound to MES
5A37 1.88 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
5A38 1.9 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
7B57 1.95 Å, Crystal structure of CaMKII-actinin complex bound to ADP
5A36 2.0 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
5A4B 2.01 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
7A8T 2.69 Å, Crystal structure of sarcomeric protein FATZ-1 (mini-FATZ-1 construct) in complex with…
1HCI 2.8 Å, Crystal structure of the rod domain of alpha-actinin
7ANK 3.2 Å, Crystal structure of sarcomeric protein FATZ-1 (d91-FATZ-1 construct) in complex with…

Browse structure collections

About this viewer

MolViewer shows 1QUU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.