Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and incorporation in muscle. Determined by X-ray diffraction at 1.9 Å resolution. Released 22 Jun 2016.
Explore 5A38 in 3D Show helices and sheets RCSB PDB PDBe
5A38 contains 33 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 36-52 | 17 | |
| α-helix | 53-55 | 3 | |
| α-helix | 70-80 | 11 | |
| α-helix | 83-87 | 5 | |
| α-helix | 93-109 | 17 | |
| α-helix | 119-123 | 5 | |
| α-helix | 127-138 | 12 | |
| α-helix | 139-143 | 5 | |
| β-strand | 147-148 | 2 | 1 |
| β-strand | 151-152 | 2 | 1 |
| α-helix | 153-164 | 12 | |
| α-helix | 178-180 | 3 | |
| α-helix | 184-193 | 10 | |
| α-helix | 195-197 | 3 | |
| α-helix | 200-202 | 3 | |
| α-helix | 208-223 | 16 | |
| α-helix | 231-235 | 5 | |
| α-helix | 242-256 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 36-52 | 17 | |
| α-helix | 53-55 | 3 | |
| α-helix | 62-65 | 4 | |
| α-helix | 70-80 | 11 | |
| α-helix | 83-86 | 4 | |
| α-helix | 93-109 | 17 | |
| α-helix | 119-123 | 5 | |
| α-helix | 127-138 | 12 | |
| α-helix | 139-143 | 5 | |
| β-strand | 147-148 | 2 | 2 |
| β-strand | 151-152 | 2 | 2 |
| α-helix | 153-165 | 13 | |
| α-helix | 178-180 | 3 | |
| α-helix | 184-193 | 10 | |
| α-helix | 195-197 | 3 | |
| α-helix | 200-202 | 3 | |
| α-helix | 208-223 | 16 | |
| α-helix | 231-236 | 6 | |
| α-helix | 242-256 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Alpha-actinin-2 | A, B | protein | 250 | HOMO SAPIENS | P35609 (AlphaFold model) |
>5A38_1 ALPHA-ACTININ-2 (chains A, B) GPYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLL EVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWT IILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPD LIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAF AGAEQAETAA
Hypertrophic Cardiomyopathy Mutations in the Calponin-Homology Domain of Actn2 Affect Actin Binding and Cardiomyocyte Z-Disc Incorporation. Haywood, N., Wolny, M., Rogers, B. et al. Biochem J (2016) 473:2485. DOI 10.1042/BCJ20160421 · PubMed
Other PDB entries of the same protein (UniProt P35609 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5A38 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.