1NYP: 4th LIM domain of PINCH protein

4th LIM domain of PINCH protein. Determined by solution NMR. Released 1 Jul 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 528
Mol. weight: 7.66 kDa
Ligands: ZN
Released: 1 Jul 2003

Explore 1NYP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NYP contains 1 α-helix and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	1
β-strand	13-14	2	1
β-strand	19-20	2	2
β-strand	26	1	1
β-strand	27-28	2	2
β-strand	33	1	3
β-strand	40	1	3
β-strand	47-49	3	4
β-strand	52-54	3	4
α-helix	56-62	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PINCH protein	A	protein	66	Homo sapiens	P48059 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NYP_1 PINCH protein (chains A)
GSMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYN
QLFGDV

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural and functional insights into PINCH LIM4 domain-mediated integrin signaling. Velyvis, A., Vaynberg, J., Yang, Y. et al. Nat Struct Biol (2003) 10:558-564. DOI 10.1038/nsb938 · PubMed

Other PDB entries of the same protein (UniProt P48059 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HI8 1.2 Å, Structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1 LIM1…
4HI9 1.2 Å, 1.2 structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1…
3F6Q 1.6 Å, Crystal structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1…
7D2S 1.65 Å, Crystal structure of Rsu1/PINCH1_LIM5C complex
7D2T 2.2 Å, Crystal structure of Rsu1/PINCH1_LIM45C complex
7LT9 3.05 Å, Crystal structure of Ras suppressor-1 in complex with PINCH-1 LIM4-5 domains
7D2U 3.15 Å, Crystal structure of Rsu1/PINCH1_LIM45C complex
1G47 1ST lim domain of pinch protein
1U5S NMR structure of the complex between Nck-2 SH3 domain and PINCH-1 LIM4 domain
2COR Solution structure of the third LIM domain of particularly interesting new Cys-His protein
2D8X Solution structure of the second LIM domain of particularly interesting new Cys-His…
2KBX Solution structure of ILK-PINCH complex

Browse structure collections

About this viewer

MolViewer shows 1NYP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.