Solution structure of the second LIM domain of particularly interesting new Cys-His protein (PINCH). Determined by solution NMR. Released 8 Jun 2006.
Explore 2D8X in 3D Show helices and sheets RCSB PDB PDBe
2D8X contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7 | 1 | 1 |
| β-strand | 14 | 1 | 1 |
| β-strand | 20-22 | 3 | 2 |
| β-strand | 25-27 | 3 | 2 |
| β-strand | 33 | 1 | 3 |
| β-strand | 40 | 1 | 3 |
| β-strand | 47-49 | 3 | 4 |
| β-strand | 52-54 | 3 | 4 |
| α-helix | 56-63 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein PINCH | A | protein | 70 | Homo sapiens | P48059 (AlphaFold model) |
>2D8X_1 Protein PINCH (chains A) GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHN REKASGPSSG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Solution structure of the second LIM domain of particularly interesting new Cys-His protein (PINCH). Qin, X.R., Hayashi, F., Yokoyama, S. To be published.
Other PDB entries of the same protein (UniProt P48059 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2D8X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.