1SRU: Full length E. coli SSB protein

Crystal structure of full length E. coli SSB protein. Determined by X-ray diffraction at 3.3 Å resolution. Released 3 Aug 2004.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Escherichia coli
Chains: 4
Atoms: 2,808
Mol. weight: 50.54 kDa
Released: 3 Aug 2004

Explore 1SRU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SRU contains 4 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1005-1014	10	1
β-strand	1019-1021	3	1
β-strand	1029-1038	10	1
β-strand	1051-1060	10	1
α-helix	1061-1070	10
β-strand	1076-1088	13	1
β-strand	1096-1102	7	1
β-strand	1108-1111	4	1

Chain B: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2005-2014	10	1
β-strand	2019-2020	2	1
β-strand	2029-2037	9	1
β-strand	2052-2060	9	1
α-helix	2061-2070	10
β-strand	2076-2088	13	1
β-strand	2096-2103	8	1
β-strand	2108-2111	4	1

Chain C: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	3005-3014	10	2
β-strand	3019-3021	3	2
β-strand	3029-3037	9	2
β-strand	3052-3060	9	2
α-helix	3061-3070	10
β-strand	3076-3088	13	2
β-strand	3096-3103	8	2
β-strand	3108-3111	4	2

Chain D: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4006-4014	9	2
β-strand	4019-4021	3	2
β-strand	4029-4038	10	2
β-strand	4051-4060	10	2
α-helix	4061-4070	10
β-strand	4076-4088	13	2
β-strand	4096-4103	8	2
β-strand	4108-4111	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Single-strand binding protein	A, B, C, D	protein	113	Escherichia coli	P0AGE0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1SRU_1 Single-strand binding protein (chains A, B, C, D)
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVL
FGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML

Primary citation

The C-terminal domain of full-length E. coli SSB is disordered even when bound to DNA. Savvides, S.N., Raghunathan, S., Fuetterer, K. et al. Protein Sci (2004) 13:1942-1947. DOI 10.1110/ps.04661904 · PubMed

Other PDB entries of the same protein (UniProt P0AGE0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UF7 1.2 Å, Co-crystal structure of Escherichia coli uracil-DNA glycosylase and a C-terminal…
8TGC 1.48 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 4
8TG8 1.58 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 3
8TG7 1.77 Å, Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 2
3SXU 1.85 Å, Structure of the E. coli SSB-DNA polymerase III interface
4Z0U 2.0 Å, RNase HI/SSB-Ct complex
1QVC 2.2 Å, Crystal structure analysis of single stranded DNA binding protein (SSB) from e.coli
4MZ9 2.2 Å, Revised structure of E. coli SSB
3Q8D 2.3 Å, E. coli RecO complex with SSB C-terminus
3C94 2.7 Å, ExoI/SSB-Ct complex
1EYG 2.8 Å, Crystal structure of chymotryptic fragment of E. coli ssb bound to two 35-mer single…
1KAW 2.9 Å, Structure of single stranded DNA binding protein (SSB)

Browse structure collections

About this viewer

MolViewer shows 1SRU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.