4D1E: Human muscle alpha-actinin-2

The crystal structure of human muscle alpha-actinin-2. Determined by X-ray diffraction at 3.5 Å resolution. Released 10 Dec 2014.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 6,865
Mol. weight: 101.85 kDa
Released: 10 Dec 2014

Explore 4D1E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4D1E contains 41 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 41 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	36-55	20
α-helix	62-65	4
α-helix	70-80	11
α-helix	86-88	3
α-helix	93-110	18
α-helix	120-123	4
α-helix	127-137	11
α-helix	138-143	6
β-strand	147-148	2	1
β-strand	151-152	2	1
α-helix	153-164	12
α-helix	184-193	10
α-helix	195-197	3
α-helix	208-220	13
α-helix	231-236	6
α-helix	242-256	15
α-helix	259-281	23
α-helix	285-290	6
α-helix	291-297	7
α-helix	298-305	8
α-helix	314-325	12
α-helix	326-330	5
α-helix	331-354	24
α-helix	368-370	3
α-helix	371-388	18
α-helix	393-417	25
α-helix	422-425	4
α-helix	434-470	37
α-helix	476-539	64
α-helix	548-589	42
α-helix	604-664	61
α-helix	671-704	34
α-helix	719-746	28
α-helix	753-762	10
α-helix	777-785	9
α-helix	788-790	3
α-helix	794-799	6
α-helix	809-810	2
α-helix	812-820	9
α-helix	828-835	8
β-strand	846	1	2
α-helix	847-853	7
α-helix	856-865	10
β-strand	868	1	3
β-strand	878	1	2
β-strand	879	1	3
α-helix	881-888	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-actinin-2	A	protein	876	HOMO SAPIENS	P35609 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4D1E_1 ALPHA-ACTININ-2 (chains A)
YMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEV
ISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTII
LRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLI
DYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAG
AEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTIPWLENRTPAATMQAMQK
KLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRL
EQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGKEQILLQKDYESASLTEVR
ALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQ
KRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAH
EQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLV
PIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQL
KQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEV
ETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRACLISMGYDLGEAEFARIM
TLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILASDKPYILAEELRRELPPDQ
AQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL

Primary citation

The Structure and Regulation of Human Muscle Alpha-Actinin. Ribeiro Jr, E.A., Pinotsis, N., Ghisleni, A. et al. Cell (2014) 159:1447. DOI 10.1016/J.CELL.2014.10.056 · PubMed

Other PDB entries of the same protein (UniProt P35609 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SWT 1.2 Å, Affimer9 co-crystalised with the CH domains of alpha actinin 2.
6TS3 1.28 Å, EF-hands 3 and 4 of alpha-actinin in complex with CaMKII regulatory segment
7B56 1.45 Å, Crystal structure of CaMKII-actinin complex bound to AMPPNP
7B55 1.6 Å, Crystal structure of CaMKII-actinin complex bound to MES
5A37 1.88 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
5A38 1.9 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
7B57 1.95 Å, Crystal structure of CaMKII-actinin complex bound to ADP
5A36 2.0 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
5A4B 2.01 Å, Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and…
1QUU 2.5 Å, Crystal structure of two central spectrin-like repeats from alpha-actinin
7A8T 2.69 Å, Crystal structure of sarcomeric protein FATZ-1 (mini-FATZ-1 construct) in complex with…
1HCI 2.8 Å, Crystal structure of the rod domain of alpha-actinin

Browse structure collections

About this viewer

MolViewer shows 4D1E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.