6MIF: Lim5 domain of PINCH1 protein

Lim5 domain of PINCH1 protein. Determined by solution NMR. Released 31 Oct 2018.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 626
Mol. weight: 9.13 kDa
Ligands: ZN
Released: 31 Oct 2018

Explore 6MIF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MIF contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	251-252	2	1
β-strand	257-258	2	1
β-strand	266	1	2
β-strand	269	1	2
β-strand	277	1	3
α-helix	283	1
β-strand	284	1	3
α-helix	285	1
β-strand	291-294	4	4
β-strand	297-300	4	4
α-helix	301-306	6
α-helix	309-322	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
LIM and senescent cell antigen-like-containing domain protein 1	A	protein	79	Homo sapiens	P48059 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6MIF_1 LIM and senescent cell antigen-like-containing domain protein 1 (chains A)
GSGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVCKKCYEK
FPLELKKRLKKLAETLGRK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Non-catalytic signaling by pseudokinase ILK for regulating cell adhesion. Vaynberg, J., Fukuda, K., Lu, F. et al. Nat Commun (2018) 9:4465-4465. DOI 10.1038/s41467-018-06906-7 · PubMed

Other PDB entries of the same protein (UniProt P48059 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HI8 1.2 Å, Structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1 LIM1…
4HI9 1.2 Å, 1.2 structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1…
3F6Q 1.6 Å, Crystal structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1…
7D2S 1.65 Å, Crystal structure of Rsu1/PINCH1_LIM5C complex
7D2T 2.2 Å, Crystal structure of Rsu1/PINCH1_LIM45C complex
7LT9 3.05 Å, Crystal structure of Ras suppressor-1 in complex with PINCH-1 LIM4-5 domains
7D2U 3.15 Å, Crystal structure of Rsu1/PINCH1_LIM45C complex
1G47 1ST lim domain of pinch protein
1NYP 4th LIM domain of PINCH protein
1U5S NMR structure of the complex between Nck-2 SH3 domain and PINCH-1 LIM4 domain
2COR Solution structure of the third LIM domain of particularly interesting new Cys-His protein
2D8X Solution structure of the second LIM domain of particularly interesting new Cys-His…

Browse structure collections

About this viewer

MolViewer shows 6MIF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.