3FRS: Human IST1(NTD) (residues 1-189)(p43212)

Structure of human IST1(NTD) (residues 1-189)(p43212). Determined by X-ray diffraction at 2.61 Å resolution. Released 30 Jun 2009.

Method: X-ray diffraction
Resolution: 2.61 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,464
Mol. weight: 21.72 kDa
Released: 30 Jun 2009

Explore 3FRS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FRS contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	8-46	39
α-helix	49-81	33
α-helix	83-86	4
α-helix	94-96	3
α-helix	97-110	14
α-helix	116-128	13
α-helix	130-137	8
α-helix	146-152	7
α-helix	156-158	3
α-helix	161-172	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uncharacterized protein KIAA0174	A	protein	189	Homo sapiens	P53990 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3FRS_1 Uncharacterized protein KIAA0174 (chains A)
GHMLGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHII
REDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIV
ADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPD
SVVMAEAPP

Primary citation

Structural basis for ESCRT-III protein autoinhibition. Bajorek, M., Schubert, H.L., McCullough, J. et al. Nat Struct Mol Biol (2009) 16:754-762. DOI 10.1038/nsmb.1621 · PubMed

Other PDB entries of the same protein (UniProt P53990 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S7J 1.15 Å, Structure of Human SPASTIN-IST1 complex.
4WZX 1.39 Å, ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins
4U7E 1.6 Å, The crystal structure of the complex of LIP5 NTD and IST1 MIM
4U7I 1.79 Å, Structure of the complex of Spartin MIT and IST1 MIM
3FRR 1.8 Å, Structure of human IST1(NTD) - (residues 1-189)(P21)
13GJ 2.0 Å, IST1 bound to PI(4,5)P2 containing membrane
4U7Y 2.5 Å, Structure of the complex of VPS4B MIT and IST1 MIM
13GH 2.56 Å, IST1 bound to PI(3,5)P2 containing membrane
8UC6 2.7 Å, Calpain-7:IST1 Complex
8V2S 2.72 Å, CHMP1B/IST1 dsDNA bound copolymer
6E8G 2.9 Å, CryoEM reconstruction of IST1-CHMP1B copolymer filament bound to ssDNA at 2.9 Angstrom…
8V2Q 2.95 Å, CHMP1B/IST1 ssRNA bound copolymer

Browse structure collections

About this viewer

MolViewer shows 3FRS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.