2KV2: Human BLM HRDC domain

Solution Structure of the human BLM HRDC domain. Determined by solution NMR. Released 15 Dec 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 672
Mol. weight: 9.59 kDa
Released: 15 Dec 2010

Explore 2KV2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KV2 contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	2-24	23
α-helix	28-31	4
α-helix	34-43	10
α-helix	48-52	5
α-helix	59-61	3
α-helix	62-66	5
α-helix	67-79	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bloom syndrome protein	A	protein	85	Homo sapiens	P54132 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KV2_1 Bloom syndrome protein (chains A)
QREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTED
KLEKYGAEVISVLQKYSEWTSPAED

Primary citation

Structure and function of the regulatory HRDC domain from human Bloom syndrome protein. Kim, Y.M., Choi, B.-S. Nucleic Acids Res (2010) 38:7764-7777. DOI 10.1093/nar/gkq586 · PubMed

Other PDB entries of the same protein (UniProt P54132 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7XV0 1.5 Å, Crystal structure of RPA70N-BLMp1 fusion
7AUC 1.53 Å, Crystal structure of an engineered helicase domain construct for human Bloom syndrome…
7XUW 1.8 Å, Crystal structure of RPA70N-BLMp2 fusion
9P3E 2.0 Å, LC3B bound to BLM peptide
5LUP 2.03 Å, Structures of DHBN domain of human BLM helicase
5MK5 2.16 Å, Structures of DHBN domain of human BLM helicase
4O3M 2.3 Å, Ternary complex of Bloom's syndrome helicase
5U6K 2.6 Å, Crystal structure of TopBP1 BRCT4/5 in complex with a BLM phosphopeptide
3WE2 2.7 Å, Structure of BLM RQC domain bound to a phosphate ion
4CDG 2.79 Å, Crystal structure of the Bloom's syndrome helicase BLM in complex with Nanobody
3WE3 2.9 Å, Structure of BLM RQC domain bound to an arsenate ion
7AUD 2.96 Å, Structure of an engineered helicase domain construct for human Bloom syndrome protein…

Browse structure collections

About this viewer

MolViewer shows 2KV2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.