9P3E: LC3B

LC3B bound to BLM peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 24 Jun 2026.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,183
Mol. weight: 17.12 kDa
Released: 24 Jun 2026

Explore 9P3E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9P3E contains 8 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	0-1	2
α-helix	2-4	3
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	1
α-helix	45-47	3
β-strand	51-55	5	1
β-strand	59	1	2
α-helix	60-71	12
β-strand	79-83	5	1
β-strand	87	1	1
β-strand	94	1	2
α-helix	95-102	8
β-strand	109-115	7	1
α-helix	116-123	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RecQ-like DNA helicase BLM,Microtubule-associated protein 1 light chain 3 beta	A	protein	145	Homo sapiens	P54132 (AlphaFold model), Q9GZQ8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9P3E_1 RecQ-like DNA helicase BLM,Microtubule-associated protein 1 light chain 3 beta (chains A)
DNFDIDDFDDDDDWEDIMGSMPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKG
EKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYE
SEKDEDGFLYMVYASQETFGMKLSV

Primary citation

A proteome-wide screen defines binding determinants of the core autophagy protein LC3B. Kosmatka, J., Halpin, J., Liu, C. et al. To be published.

Other PDB entries of the same protein (UniProt P54132 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7XV0 1.5 Å, Crystal structure of RPA70N-BLMp1 fusion
7AUC 1.53 Å, Crystal structure of an engineered helicase domain construct for human Bloom syndrome…
7XUW 1.8 Å, Crystal structure of RPA70N-BLMp2 fusion
5LUP 2.03 Å, Structures of DHBN domain of human BLM helicase
5MK5 2.16 Å, Structures of DHBN domain of human BLM helicase
4O3M 2.3 Å, Ternary complex of Bloom's syndrome helicase
5U6K 2.6 Å, Crystal structure of TopBP1 BRCT4/5 in complex with a BLM phosphopeptide
3WE2 2.7 Å, Structure of BLM RQC domain bound to a phosphate ion
4CDG 2.79 Å, Crystal structure of the Bloom's syndrome helicase BLM in complex with Nanobody
3WE3 2.9 Å, Structure of BLM RQC domain bound to an arsenate ion
7AUD 2.96 Å, Structure of an engineered helicase domain construct for human Bloom syndrome protein…
4CGZ 3.2 Å, Crystal structure of the Bloom's syndrome helicase BLM in complex with DNA

Browse structure collections

About this viewer

MolViewer shows 9P3E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.