3WE2: BLM RQC domain

Structure of BLM RQC domain bound to a phosphate ion. Determined by X-ray diffraction at 2.7 Å resolution. Released 13 Nov 2013.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,839
Mol. weight: 32.75 kDa
Ligands: PO4
Released: 13 Nov 2013

Explore 3WE2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WE2 contains 9 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1075-1076	2	1
α-helix	1078-1090	13
β-strand	1093	1	2
β-strand	1102	1	2
α-helix	1111-1118	8
α-helix	1133-1136	4
β-strand	1138	1	3
α-helix	1139-1151	13
β-strand	1155-1161	7	4
β-strand	1167-1173	7	4
α-helix	1177-1181	5
β-strand	1188-1189	2	1

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1075-1076	2	5
α-helix	1078-1092	15
β-strand	1109	1	6
α-helix	1111-1119	9
β-strand	1138	1	3
α-helix	1139-1151	13
β-strand	1155-1161	7	6
β-strand	1167-1173	7	6
α-helix	1177-1181	5
β-strand	1188-1189	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bloom syndrome protein	A, B	protein	147	Homo sapiens	P54132 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3WE2_1 Bloom syndrome protein (chains A, B)
GPLGSKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSK
SAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLN
GNLKVDFMETENSSSVKKQKALVAKVS

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (ACT) are not listed.

Primary citation

Structure of the RecQ C-terminal Domain of Human Bloom Syndrome Protein. Kim, S.Y., Hakoshima, T., Kitano, K. Sci Rep (2013) 3:3294-3294. DOI 10.1038/srep03294 · PubMed

Other PDB entries of the same protein (UniProt P54132 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7XV0 1.5 Å, Crystal structure of RPA70N-BLMp1 fusion
7AUC 1.53 Å, Crystal structure of an engineered helicase domain construct for human Bloom syndrome…
7XUW 1.8 Å, Crystal structure of RPA70N-BLMp2 fusion
9P3E 2.0 Å, LC3B bound to BLM peptide
5LUP 2.03 Å, Structures of DHBN domain of human BLM helicase
5MK5 2.16 Å, Structures of DHBN domain of human BLM helicase
4O3M 2.3 Å, Ternary complex of Bloom's syndrome helicase
5U6K 2.6 Å, Crystal structure of TopBP1 BRCT4/5 in complex with a BLM phosphopeptide
4CDG 2.79 Å, Crystal structure of the Bloom's syndrome helicase BLM in complex with Nanobody
3WE3 2.9 Å, Structure of BLM RQC domain bound to an arsenate ion
7AUD 2.96 Å, Structure of an engineered helicase domain construct for human Bloom syndrome protein…
4CGZ 3.2 Å, Crystal structure of the Bloom's syndrome helicase BLM in complex with DNA

Browse structure collections

About this viewer

MolViewer shows 3WE2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.