Crystal structure of the Bloom's syndrome helicase BLM in complex with Nanobody. Determined by X-ray diffraction at 2.79 Å resolution. Released 13 Nov 2013.
Explore 4CDG in 3D Show helices and sheets RCSB PDB PDBe
4CDG contains 77 α-helices and 57 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 642-644 | 3 | |
| α-helix | 652-661 | 10 | |
| α-helix | 672-679 | 8 | |
| β-strand | 685-688 | 4 | 1 |
| α-helix | 697-704 | 8 | |
| β-strand | 709-713 | 5 | 1 |
| α-helix | 717-728 | 12 | |
| β-strand | 734-737 | 4 | 1 |
| α-helix | 743-754 | 12 | |
| β-strand | 762-765 | 4 | 1 |
| α-helix | 767-772 | 6 | |
| α-helix | 774-785 | 12 | |
| β-strand | 789-794 | 6 | 1 |
| α-helix | 797-800 | 4 | |
| α-helix | 809-814 | 6 | |
| α-helix | 815-820 | 6 | |
| β-strand | 826-830 | 5 | 1 |
| α-helix | 835-845 | 11 | |
| β-strand | 851-853 | 3 | 1 |
| β-strand | 862-868 | 7 | 2 |
| α-helix | 874-885 | 12 | |
| β-strand | 891-895 | 5 | 2 |
| α-helix | 898-909 | 12 | |
| β-strand | 915-918 | 4 | 2 |
| α-helix | 924-935 | 12 | |
| β-strand | 942-946 | 5 | 2 |
| α-helix | 947-950 | 4 | |
| β-strand | 960-963 | 4 | 2 |
| α-helix | 970-978 | 9 | |
| β-strand | 987-993 | 7 | 2 |
| α-helix | 996-1002 | 7 | |
| α-helix | 1016-1031 | 16 | |
| α-helix | 1037-1043 | 7 | |
| α-helix | 1054-1057 | 4 | |
| α-helix | 1059-1061 | 3 | |
| α-helix | 1064-1068 | 5 | |
| β-strand | 1074-1076 | 3 | 3 |
| α-helix | 1078-1090 | 13 | |
| α-helix | 1111-1119 | 9 | |
| α-helix | 1139-1151 | 13 | |
| β-strand | 1155-1161 | 7 | 4 |
| β-strand | 1167-1173 | 7 | 4 |
| α-helix | 1178-1181 | 4 | |
| β-strand | 1188-1190 | 3 | 3 |
| α-helix | 1195-1197 | 3 | |
| α-helix | 1198-1200 | 3 | |
| α-helix | 1206-1208 | 3 | |
| α-helix | 1210-1233 | 24 | |
| α-helix | 1237-1239 | 3 | |
| α-helix | 1243-1252 | 10 | |
| α-helix | 1257-1260 | 4 | |
| α-helix | 1270-1273 | 4 | |
| α-helix | 1275-1283 | 9 | |
| α-helix | 1286-1288 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 642-645 | 4 | |
| α-helix | 652-661 | 10 | |
| α-helix | 672-679 | 8 | |
| β-strand | 685-688 | 4 | 5 |
| α-helix | 697-704 | 8 | |
| β-strand | 709-713 | 5 | 5 |
| α-helix | 717-728 | 12 | |
| β-strand | 734-737 | 4 | 5 |
| α-helix | 743-754 | 12 | |
| β-strand | 762-765 | 4 | 5 |
| α-helix | 767-772 | 6 | |
| α-helix | 774-785 | 12 | |
| β-strand | 789-794 | 6 | 5 |
| α-helix | 797-800 | 4 | |
| α-helix | 809-814 | 6 | |
| α-helix | 816-820 | 5 | |
| β-strand | 826-830 | 5 | 5 |
| α-helix | 835-844 | 10 | |
| β-strand | 851-853 | 3 | 5 |
| β-strand | 862-868 | 7 | 6 |
| α-helix | 874-885 | 12 | |
| β-strand | 891-895 | 5 | 6 |
| α-helix | 898-910 | 13 | |
| β-strand | 915-918 | 4 | 6 |
| α-helix | 924-935 | 12 | |
| β-strand | 942-946 | 5 | 6 |
| α-helix | 947-950 | 4 | |
| β-strand | 960-963 | 4 | 6 |
| α-helix | 970-978 | 9 | |
| β-strand | 987-993 | 7 | 6 |
| α-helix | 996-1002 | 7 | |
| α-helix | 1018-1031 | 14 | |
| α-helix | 1037-1043 | 7 | |
| α-helix | 1054-1057 | 4 | |
| α-helix | 1059-1061 | 3 | |
| α-helix | 1064-1067 | 4 | |
| β-strand | 1074-1076 | 3 | 7 |
| α-helix | 1078-1090 | 13 | |
| β-strand | 1109 | 1 | 8 |
| α-helix | 1111-1119 | 9 | |
| α-helix | 1139-1151 | 13 | |
| β-strand | 1155-1161 | 7 | 8 |
| β-strand | 1167-1173 | 7 | 8 |
| α-helix | 1178-1181 | 4 | |
| β-strand | 1188-1190 | 3 | 7 |
| α-helix | 1195-1197 | 3 | |
| α-helix | 1198-1200 | 3 | |
| α-helix | 1210-1233 | 24 | |
| α-helix | 1237-1239 | 3 | |
| α-helix | 1243-1252 | 10 | |
| α-helix | 1257-1260 | 4 | |
| α-helix | 1268-1273 | 6 | |
| α-helix | 1275-1283 | 9 | |
| α-helix | 1286-1288 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 25-29 | 5 | 9 |
| β-strand | 32-35 | 4 | 10 |
| β-strand | 40-47 | 8 | 9 |
| β-strand | 55-61 | 7 | 10 |
| β-strand | 68-74 | 7 | 10 |
| β-strand | 79-81 | 3 | 10 |
| α-helix | 83-85 | 3 | |
| β-strand | 89-94 | 6 | 9 |
| β-strand | 99-104 | 6 | 9 |
| α-helix | 109-111 | 3 | |
| β-strand | 113-120 | 8 | 10 |
| β-strand | 129-131 | 3 | 10 |
| β-strand | 135-140 | 6 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bloom syndrome protein | A, B | protein | 673 | HOMO SAPIENS | P54132 (AlphaFold model) |
| Nanobody | C, D | protein | 147 | LAMA GLAMA |
>4CDG_1 BLOOM SYNDROME PROTEIN (chains A, B) SMSRNLKHERFQSLSFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGG GKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSLDIPATYLTGDKTDSEATNIYLQL SKKDPIIKLLYVTPEKICASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYKR MNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKPKK VAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQRDGLAALAYHAGLSDSARDEVQQK WINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKSVEGYYQESGRAGRDGEISHCLLFY TYHDVTRLKRLIMMEKDGNHHTRETHFNNLYSMVHYCENITECRRIQLLAYFGENGFNPD FCKKHPDVSCDNCCKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNM LVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVML GNKAQTVLNGNLKVDFMETENSSSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVF GVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAE DSSPGMSENLYFQ
>4CDG_2 NANOBODY (chains C, D) MKYLLPTAAAGLLLLAAQPAMAQVQLQESGGGLVQAGGSLRLSCAASGIWFSINNMAWYR QTPGKQRERIAIITSAGTTNYVDSVKGRFTISRDDAKNTMYLQMNSLIPEDTAVYYCNLV ADYDMGFQSFWGRGTQVTVSSHHHHHH
Crystal Structure of the Bloom'S Syndrome Helicase Indicates a Role for the Hrdc Domain in Conformational Changes. Newman, J.A., Savitsky, P., Allerston, C.K. et al. Nucleic Acids Res (2015) 43:5221. DOI 10.1093/NAR/GKV373 · PubMed
Other PDB entries of the same protein (UniProt P54132 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4CDG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.