7AUD: Bloom syndrome protein,Bloom syndrome protein
Structure of an engineered helicase domain construct for human Bloom syndrome protein (BLM). Determined by X-ray diffraction at 2.96 Å resolution. Released 16 Dec 2020.
- Method
- X-ray diffraction
- Resolution
- 2.96 Å
- Organisms
- Homo sapiens, synthetic construct
- Chains
- 12
- Atoms
- 25,271
- Mol. weight
- 417.98 kDa
- Ligands
- ZN, ADP, RY8, MG
- Released
- 16 Dec 2020
Explore 7AUD in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7AUD contains 165 α-helices and 78 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 27 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 652-661 | 10 | |
| α-helix | 672-680 | 9 | |
| β-strand | 685-688 | 4 | 1 |
| α-helix | 695-705 | 11 | |
| β-strand | 709-713 | 5 | 1 |
| α-helix | 717-729 | 13 | |
| β-strand | 734-736 | 3 | 1 |
| α-helix | 743-754 | 12 | |
| β-strand | 762-765 | 4 | 1 |
| α-helix | 767-770 | 4 | |
| α-helix | 774-785 | 12 | |
| β-strand | 789-795 | 7 | 1 |
| α-helix | 798-803 | 6 | |
| α-helix | 810-813 | 4 | |
| α-helix | 816-820 | 5 | |
| β-strand | 826-830 | 5 | 1 |
| α-helix | 835-844 | 10 | |
| β-strand | 851-853 | 3 | 1 |
| β-strand | 862-868 | 7 | 2 |
| α-helix | 874-885 | 12 | |
| β-strand | 890-894 | 5 | 2 |
| α-helix | 898-910 | 13 | |
| β-strand | 915-918 | 4 | 2 |
| α-helix | 924-935 | 12 | |
| β-strand | 942-945 | 4 | 2 |
| β-strand | 958-963 | 6 | 2 |
| α-helix | 970-978 | 9 | |
| β-strand | 987-993 | 7 | 2 |
| α-helix | 995-1006 | 12 | |
| α-helix | 1013-1031 | 19 | |
| α-helix | 1037-1044 | 8 | |
| α-helix | 1054-1057 | 4 | |
| α-helix | 1059-1061 | 3 | |
| α-helix | 1065-1067 | 3 | |
| α-helix | 1204-1233 | 30 | |
| α-helix | 1237-1239 | 3 | |
| α-helix | 1243-1252 | 10 | |
| α-helix | 1257-1260 | 4 | |
| α-helix | 1268-1283 | 16 | |
| α-helix | 1286-1288 | 3 | |
Chain B: 27 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 639-644 | 6 | |
| α-helix | 652-661 | 10 | |
| α-helix | 672-680 | 9 | |
| β-strand | 685-688 | 4 | 3 |
| α-helix | 695-705 | 11 | |
| β-strand | 709-713 | 5 | 3 |
| α-helix | 717-729 | 13 | |
| β-strand | 734-736 | 3 | 3 |
| α-helix | 743-754 | 12 | |
| β-strand | 762-765 | 4 | 3 |
| α-helix | 767-770 | 4 | |
| α-helix | 774-785 | 12 | |
| β-strand | 789-795 | 7 | 3 |
| α-helix | 798-803 | 6 | |
| α-helix | 810-813 | 4 | |
| α-helix | 816-820 | 5 | |
| β-strand | 826-830 | 5 | 3 |
| α-helix | 835-844 | 10 | |
| β-strand | 851-853 | 3 | 3 |
| β-strand | 862-868 | 7 | 4 |
| α-helix | 874-885 | 12 | |
| β-strand | 891-894 | 4 | 4 |
| α-helix | 898-910 | 13 | |
| β-strand | 915-918 | 4 | 4 |
| α-helix | 924-936 | 13 | |
| β-strand | 942-945 | 4 | 4 |
| β-strand | 960-963 | 4 | 4 |
| α-helix | 970-977 | 8 | |
| β-strand | 987-993 | 7 | 4 |
| α-helix | 995-1006 | 12 | |
| α-helix | 1013-1031 | 19 | |
| α-helix | 1037-1044 | 8 | |
| α-helix | 1054-1057 | 4 | |
| α-helix | 1059-1061 | 3 | |
| α-helix | 1210-1233 | 24 | |
| α-helix | 1237-1239 | 3 | |
| α-helix | 1243-1252 | 10 | |
| α-helix | 1257-1260 | 4 | |
| α-helix | 1268-1285 | 18 | |
| α-helix | 1286-1288 | 3 | |
Chain C: 27 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 639-644 | 6 | |
| α-helix | 652-661 | 10 | |
| α-helix | 672-680 | 9 | |
| β-strand | 685-688 | 4 | 5 |
| α-helix | 695-705 | 11 | |
| β-strand | 709-713 | 5 | 5 |
| α-helix | 717-729 | 13 | |
| β-strand | 734-736 | 3 | 5 |
| α-helix | 743-754 | 12 | |
| β-strand | 762-765 | 4 | 5 |
| α-helix | 767-770 | 4 | |
| α-helix | 774-785 | 12 | |
| β-strand | 789-795 | 7 | 5 |
| α-helix | 798-803 | 6 | |
| α-helix | 810-813 | 4 | |
| α-helix | 816-820 | 5 | |
| β-strand | 826-830 | 5 | 5 |
| α-helix | 835-844 | 10 | |
| β-strand | 851-853 | 3 | 5 |
| β-strand | 862-868 | 7 | 6 |
| α-helix | 874-885 | 12 | |
| β-strand | 890-894 | 5 | 6 |
| α-helix | 898-910 | 13 | |
| β-strand | 915-918 | 4 | 6 |
| α-helix | 924-935 | 12 | |
| β-strand | 942-945 | 4 | 6 |
| β-strand | 958-963 | 6 | 6 |
| α-helix | 970-977 | 8 | |
| β-strand | 987-993 | 7 | 6 |
| α-helix | 995-1006 | 12 | |
| α-helix | 1013-1030 | 18 | |
| α-helix | 1037-1044 | 8 | |
| α-helix | 1054-1057 | 4 | |
| α-helix | 1059-1061 | 3 | |
| α-helix | 1211-1233 | 23 | |
| α-helix | 1237-1239 | 3 | |
| α-helix | 1243-1252 | 10 | |
| α-helix | 1257-1261 | 5 | |
| α-helix | 1268-1282 | 15 | |
| α-helix | 1283-1288 | 6 | |
Chain D: 29 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 642-644 | 3 | |
| α-helix | 652-657 | 6 | |
| α-helix | 658-662 | 5 | |
| α-helix | 672-680 | 9 | |
| β-strand | 685-688 | 4 | 7 |
| α-helix | 695-705 | 11 | |
| β-strand | 709-713 | 5 | 7 |
| α-helix | 717-729 | 13 | |
| β-strand | 734-736 | 3 | 7 |
| α-helix | 743-754 | 12 | |
| β-strand | 762-765 | 4 | 7 |
| α-helix | 767-770 | 4 | |
| α-helix | 774-785 | 12 | |
| β-strand | 789-795 | 7 | 7 |
| α-helix | 798-803 | 6 | |
| α-helix | 810-813 | 4 | |
| α-helix | 814-816 | 3 | |
| α-helix | 817-820 | 4 | |
| β-strand | 826-830 | 5 | 7 |
| α-helix | 835-844 | 10 | |
| β-strand | 851-853 | 3 | 7 |
| β-strand | 862-868 | 7 | 8 |
| α-helix | 874-885 | 12 | |
| β-strand | 890-894 | 5 | 8 |
| α-helix | 898-910 | 13 | |
| β-strand | 915-918 | 4 | 8 |
| α-helix | 924-936 | 13 | |
| β-strand | 942-945 | 4 | 8 |
| β-strand | 958-963 | 6 | 8 |
| α-helix | 970-977 | 8 | |
| β-strand | 987-993 | 7 | 8 |
| α-helix | 995-1006 | 12 | |
| α-helix | 1013-1031 | 19 | |
| α-helix | 1037-1044 | 8 | |
| α-helix | 1054-1057 | 4 | |
| α-helix | 1059-1061 | 3 | |
| α-helix | 1211-1233 | 23 | |
| α-helix | 1237-1239 | 3 | |
| α-helix | 1243-1252 | 10 | |
| α-helix | 1257-1260 | 4 | |
| α-helix | 1268-1282 | 15 | |
| α-helix | 1283-1288 | 6 | |
Chain E: 28 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 639-643 | 5 | |
| α-helix | 652-657 | 6 | |
| α-helix | 658-662 | 5 | |
| α-helix | 672-680 | 9 | |
| β-strand | 685-688 | 4 | 9 |
| α-helix | 695-705 | 11 | |
| β-strand | 709-713 | 5 | 9 |
| α-helix | 717-729 | 13 | |
| β-strand | 734-736 | 3 | 9 |
| α-helix | 743-754 | 12 | |
| β-strand | 762-765 | 4 | 9 |
| α-helix | 767-770 | 4 | |
| α-helix | 774-785 | 12 | |
| β-strand | 789-795 | 7 | 9 |
| α-helix | 798-803 | 6 | |
| α-helix | 810-813 | 4 | |
| α-helix | 815-820 | 6 | |
| β-strand | 826-830 | 5 | 9 |
| α-helix | 835-844 | 10 | |
| β-strand | 851-854 | 4 | 9 |
| β-strand | 862-868 | 7 | 10 |
| α-helix | 874-885 | 12 | |
| β-strand | 891-894 | 4 | 10 |
| α-helix | 898-910 | 13 | |
| β-strand | 915-918 | 4 | 10 |
| α-helix | 924-936 | 13 | |
| β-strand | 942-945 | 4 | 10 |
| β-strand | 960-963 | 4 | 10 |
| α-helix | 970-978 | 9 | |
| β-strand | 987-993 | 7 | 10 |
| α-helix | 995-1006 | 12 | |
| α-helix | 1013-1031 | 19 | |
| α-helix | 1037-1044 | 8 | |
| α-helix | 1054-1057 | 4 | |
| α-helix | 1059-1061 | 3 | |
| α-helix | 1211-1233 | 23 | |
| α-helix | 1237-1239 | 3 | |
| α-helix | 1243-1252 | 10 | |
| α-helix | 1257-1261 | 5 | |
| α-helix | 1268-1282 | 15 | |
| α-helix | 1283-1288 | 6 | |
Chain F: 27 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 641-644 | 4 | |
| α-helix | 652-661 | 10 | |
| α-helix | 672-680 | 9 | |
| β-strand | 685-688 | 4 | 11 |
| α-helix | 695-705 | 11 | |
| β-strand | 709-713 | 5 | 11 |
| α-helix | 717-729 | 13 | |
| β-strand | 734-736 | 3 | 11 |
| α-helix | 743-754 | 12 | |
| β-strand | 762-765 | 4 | 11 |
| α-helix | 767-770 | 4 | |
| α-helix | 774-785 | 12 | |
| β-strand | 789-795 | 7 | 11 |
| α-helix | 798-803 | 6 | |
| α-helix | 810-813 | 4 | |
| α-helix | 816-820 | 5 | |
| β-strand | 826-830 | 5 | 11 |
| α-helix | 835-844 | 10 | |
| β-strand | 851-853 | 3 | 11 |
| β-strand | 862-868 | 7 | 12 |
| α-helix | 874-885 | 12 | |
| β-strand | 890-894 | 5 | 12 |
| α-helix | 898-910 | 13 | |
| β-strand | 915-918 | 4 | 12 |
| α-helix | 924-935 | 12 | |
| β-strand | 942-945 | 4 | 12 |
| β-strand | 958-963 | 6 | 12 |
| α-helix | 970-977 | 8 | |
| β-strand | 987-993 | 7 | 12 |
| α-helix | 995-1006 | 12 | |
| α-helix | 1013-1031 | 19 | |
| α-helix | 1037-1044 | 8 | |
| α-helix | 1054-1057 | 4 | |
| α-helix | 1059-1061 | 3 | |
| α-helix | 1204-1233 | 30 | |
| α-helix | 1237-1239 | 3 | |
| α-helix | 1243-1252 | 10 | |
| α-helix | 1257-1260 | 4 | |
| α-helix | 1268-1279 | 12 | |
| α-helix | 1282-1285 | 4 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Bloom syndrome protein,Bloom syndrome protein | A, B, C, D, E, F | protein | 563 | Homo sapiens | P54132 (AlphaFold model) |
| DNA (5'-d(*gp*tp*ap*cp*cp*cp*gp*ap*tp*gp*tp*gp*t)-3') | M, N, O, P, Q, R | DNA | 15 | synthetic construct | |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>7AUD_1 Bloom syndrome protein,Bloom syndrome protein (chains A, B, C, D, E, F)
MGSAWSHPQFEKSSGLEVLFQGGPHMSRNLKHERFQSLSFPHTKEMMKIFHKKFGLHNFR
TNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTS
LDIPATYLTGDKTDSEATNIYLQLSKKDPIIKLLYVTPEKICASNRLISTLENLYERKLL
ARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDILTQLKILR
PQVFSMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQ
RDGLAALAYHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKS
VEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMMEKDGNHHTRETHFNNLYSMVHY
CENITECRRIQLLAYFGENGFNPDFCKKHPDVSCDNCCKTKGSGGSKALVAKVSQREEMV
KKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYG
AEVISVLQKYSEWTSPAEDSSPG
Sequence of entity 2 (M, N, O, P, Q, R), FASTA
>7AUD_2 DNA (5'-D(*GP*TP*AP*CP*CP*CP*GP*AP*TP*GP*TP*GP*T)-3') (chains M, N, O, P, Q, R)
CGTACCCGATGTGTT
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 6 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 6 |
| RY8 | N-(2,3-dimethyl-5-sulfamoylphenyl)-4-(2-methylthiazol-4-yl)benzamide | C19 H19 N3 O3 S2 | 6 |
| MG | Magnesium ion | Mg | 6 |
Water and common crystallization additives (PG4) are not listed.
Primary citation
Uncovering an allosteric mode of action for a selective inhibitor of human Bloom syndrome protein. Chen, X., Ali, Y.I., Fisher, C.E. et al. Elife (2021) 10. DOI 10.7554/eLife.65339 · PubMed
Other PDB entries of the same protein (UniProt P54132 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7XV0 1.5 Å, Crystal structure of RPA70N-BLMp1 fusion
- 7AUC 1.53 Å, Crystal structure of an engineered helicase domain construct for human Bloom syndrome…
- 7XUW 1.8 Å, Crystal structure of RPA70N-BLMp2 fusion
- 9P3E 2.0 Å, LC3B bound to BLM peptide
- 5LUP 2.03 Å, Structures of DHBN domain of human BLM helicase
- 5MK5 2.16 Å, Structures of DHBN domain of human BLM helicase
- 4O3M 2.3 Å, Ternary complex of Bloom's syndrome helicase
- 5U6K 2.6 Å, Crystal structure of TopBP1 BRCT4/5 in complex with a BLM phosphopeptide
- 3WE2 2.7 Å, Structure of BLM RQC domain bound to a phosphate ion
- 4CDG 2.79 Å, Crystal structure of the Bloom's syndrome helicase BLM in complex with Nanobody
- 3WE3 2.9 Å, Structure of BLM RQC domain bound to an arsenate ion
- 4CGZ 3.2 Å, Crystal structure of the Bloom's syndrome helicase BLM in complex with DNA
Browse structure collections
About this viewer
MolViewer shows 7AUD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.