7AUC: Bloom syndrome protein,Bloom syndrome protein

Crystal structure of an engineered helicase domain construct for human Bloom syndrome protein (BLM). Determined by X-ray diffraction at 1.53 Å resolution. Released 16 Dec 2020.

Method: X-ray diffraction
Resolution: 1.53 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,385
Mol. weight: 65.59 kDa
Ligands: ADP, ZN, CA, MG
Released: 16 Dec 2020

Explore 7AUC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7AUC contains 28 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	640-643	4
α-helix	652-661	10
α-helix	668-669	2
α-helix	672-680	9
β-strand	685-688	4	1
α-helix	695-705	11
β-strand	709-713	5	1
α-helix	717-729	13
β-strand	734-737	4	1
α-helix	745-753	9
β-strand	762-765	4	1
α-helix	767-770	4
α-helix	774-785	12
β-strand	789-795	7	1
β-strand	826-830	5	1
α-helix	835-845	11
α-helix	846-848	3
β-strand	851-853	3	1
β-strand	862-868	7	2
α-helix	874-885	12
β-strand	891-894	4	2
α-helix	898-910	13
β-strand	915-918	4	2
α-helix	924-935	12
β-strand	942-945	4	2
α-helix	947-950	4
β-strand	960-963	4	2
α-helix	970-977	8
β-strand	987-993	7	2
α-helix	995-1007	13
α-helix	1013-1031	19
α-helix	1037-1044	8
α-helix	1054-1057	4
α-helix	1059-1061	3
α-helix	1064-1067	4
α-helix	1210-1233	24
α-helix	1237-1239	3
α-helix	1243-1252	10
α-helix	1257-1260	4
α-helix	1268-1283	16
α-helix	1286-1288	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bloom syndrome protein,Bloom syndrome protein	A	protein	562	Homo sapiens	P54132 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7AUC_1 Bloom syndrome protein,Bloom syndrome protein (chains A)
MGSAWSHPQFEKSSGLEVLFQGPHMSRNLKHERFQSLSFPHTKEMMKIFHKKFGLHNFRT
NQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSL
DIPATYLTGDKTDSEATNIYLQLSKKDPIIKLLYVTPEKICASNRLISTLENLYERKLLA
RFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRP
QVFSMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQR
DGLAALAYHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKSV
EGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMMEKDGNHHTRETHFNNLYSMVHYC
ENITECRRIQLLAYFGENGFNPDFCKKHPDVSCDNCCKTKGSGGSKALVAKVSQREEMVK
KCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGA
EVISVLQKYSEWTSPAEDSSPG

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
ZN	Zinc ion	Zn	1
CA	Calcium ion	Ca	2
MG	Magnesium ion	Mg	2

Water and common crystallization additives (ACT, EDO, PG4, GOL) are not listed.

Primary citation

Uncovering an allosteric mode of action for a selective inhibitor of human Bloom syndrome protein. Chen, X., Ali, Y.I., Fisher, C.E. et al. Elife (2021) 10. DOI 10.7554/eLife.65339 · PubMed

Other PDB entries of the same protein (UniProt P54132 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7XV0 1.5 Å, Crystal structure of RPA70N-BLMp1 fusion
7XUW 1.8 Å, Crystal structure of RPA70N-BLMp2 fusion
9P3E 2.0 Å, LC3B bound to BLM peptide
5LUP 2.03 Å, Structures of DHBN domain of human BLM helicase
5MK5 2.16 Å, Structures of DHBN domain of human BLM helicase
4O3M 2.3 Å, Ternary complex of Bloom's syndrome helicase
5U6K 2.6 Å, Crystal structure of TopBP1 BRCT4/5 in complex with a BLM phosphopeptide
3WE2 2.7 Å, Structure of BLM RQC domain bound to a phosphate ion
4CDG 2.79 Å, Crystal structure of the Bloom's syndrome helicase BLM in complex with Nanobody
3WE3 2.9 Å, Structure of BLM RQC domain bound to an arsenate ion
7AUD 2.96 Å, Structure of an engineered helicase domain construct for human Bloom syndrome protein…
4CGZ 3.2 Å, Crystal structure of the Bloom's syndrome helicase BLM in complex with DNA

Browse structure collections

About this viewer

MolViewer shows 7AUC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.