Structure of BLM RQC domain bound to an arsenate ion. Determined by X-ray diffraction at 2.9 Å resolution. Released 13 Nov 2013.
Explore 3WE3 in 3D Show helices and sheets RCSB PDB PDBe
3WE3 contains 9 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1076 | 1 | 1 |
| α-helix | 1078-1090 | 13 | |
| β-strand | 1093 | 1 | 2 |
| β-strand | 1102 | 1 | 2 |
| α-helix | 1109-1110 | 2 | |
| α-helix | 1111-1118 | 8 | |
| α-helix | 1139-1151 | 13 | |
| β-strand | 1155-1161 | 7 | 3 |
| β-strand | 1167-1173 | 7 | 3 |
| α-helix | 1177-1180 | 4 | |
| β-strand | 1188 | 1 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1075-1076 | 2 | 4 |
| α-helix | 1078-1092 | 15 | |
| β-strand | 1109-1110 | 2 | 5 |
| α-helix | 1111-1118 | 8 | |
| α-helix | 1139-1151 | 13 | |
| β-strand | 1155-1161 | 7 | 5 |
| β-strand | 1167-1173 | 7 | 5 |
| α-helix | 1177-1181 | 5 | |
| β-strand | 1188-1189 | 2 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bloom syndrome protein | A, B | protein | 147 | Homo sapiens | P54132 (AlphaFold model) |
>3WE3_1 Bloom syndrome protein (chains A, B) GPLGSKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSK SAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLN GNLKVDFMETENSSSVKKQKALVAKVS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ART | Arsenate | As O4 | 1 |
Water and common crystallization additives (ACT) are not listed.
Structure of the RecQ C-terminal Domain of Human Bloom Syndrome Protein. Kim, S.Y., Hakoshima, T., Kitano, K. Sci Rep (2013) 3:3294-3294. DOI 10.1038/srep03294 · PubMed
Other PDB entries of the same protein (UniProt P54132 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3WE3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.