2RRD: HRDC domain from Bloom syndrome protein

Structure of HRDC domain from human Bloom syndrome protein, BLM. Determined by solution NMR. Released 8 Sept 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 792
Mol. weight: 11.28 kDa
Released: 8 Sept 2010

Explore 2RRD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RRD contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	16-38	23
α-helix	43-46	4
α-helix	49-58	10
α-helix	63-67	5
α-helix	74-79	6
α-helix	81-95	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HRDC domain from Bloom syndrome protein	A	protein	101	Homo sapiens	P54132 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2RRD_1 HRDC domain from Bloom syndrome protein (chains A)
GIPEFKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLS
SDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS

Primary citation

Solution structure of the HRDC domain of human Bloom syndrome protein BLM. Sato, A., Mishima, M., Nagai, A. et al. J Biochem (2010) 148:517-525. DOI 10.1093/jb/mvq097 · PubMed

Other PDB entries of the same protein (UniProt P54132 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7XV0 1.5 Å, Crystal structure of RPA70N-BLMp1 fusion
7AUC 1.53 Å, Crystal structure of an engineered helicase domain construct for human Bloom syndrome…
7XUW 1.8 Å, Crystal structure of RPA70N-BLMp2 fusion
9P3E 2.0 Å, LC3B bound to BLM peptide
5LUP 2.03 Å, Structures of DHBN domain of human BLM helicase
5MK5 2.16 Å, Structures of DHBN domain of human BLM helicase
4O3M 2.3 Å, Ternary complex of Bloom's syndrome helicase
5U6K 2.6 Å, Crystal structure of TopBP1 BRCT4/5 in complex with a BLM phosphopeptide
3WE2 2.7 Å, Structure of BLM RQC domain bound to a phosphate ion
4CDG 2.79 Å, Crystal structure of the Bloom's syndrome helicase BLM in complex with Nanobody
3WE3 2.9 Å, Structure of BLM RQC domain bound to an arsenate ion
7AUD 2.96 Å, Structure of an engineered helicase domain construct for human Bloom syndrome protein…

Browse structure collections

About this viewer

MolViewer shows 2RRD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.