4CGZ: Bloom's syndrome helicase BLM

Crystal structure of the Bloom's syndrome helicase BLM in complex with DNA. Determined by X-ray diffraction at 3.2 Å resolution. Released 11 Dec 2013.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: HOMO SAPIENS, SYNTHETIC CONSTRUCT
Chains: 3
Atoms: 5,591
Mol. weight: 84.97 kDa
Ligands: ADP, ZN
Released: 11 Dec 2013

Explore 4CGZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CGZ contains 34 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 34 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	642-644	3
α-helix	652-661	10
α-helix	672-679	8
β-strand	685-688	4	1
α-helix	697-704	8
β-strand	709-713	5	1
α-helix	717-728	12
β-strand	734-737	4	1
α-helix	743-754	12
β-strand	762-765	4	1
α-helix	767-772	6
α-helix	774-785	12
β-strand	789-794	6	1
α-helix	797-800	4
α-helix	809-814	6
α-helix	815-820	6
β-strand	826-830	5	1
α-helix	835-845	11
β-strand	851-853	3	1
β-strand	862-868	7	2
α-helix	874-885	12
β-strand	891-894	4	2
α-helix	898-909	12
β-strand	915-918	4	2
α-helix	924-935	12
β-strand	942-945	4	2
α-helix	947-950	4
β-strand	960-963	4	2
α-helix	970-978	9
β-strand	987-993	7	2
α-helix	996-1007	12
α-helix	1016-1031	16
α-helix	1037-1043	7
α-helix	1054-1057	4
α-helix	1059-1061	3
α-helix	1064-1067	4
β-strand	1075-1076	2	3
α-helix	1078-1092	15
β-strand	1110	1	4
α-helix	1111-1119	9
α-helix	1141-1147	7
β-strand	1157-1160	4	4
β-strand	1168-1171	4	4
α-helix	1177-1182	6
β-strand	1188-1189	2	3
α-helix	1210-1233	24
α-helix	1237-1239	3
α-helix	1243-1252	10
α-helix	1257-1260	4
α-helix	1270-1273	4
α-helix	1275-1283	9
α-helix	1286-1288	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bloom's syndrome helicase	A	protein	665	HOMO SAPIENS	P54132 (AlphaFold model)
5'-d(apgpcpgptpcpgpapgpaptpcp)-3'	B	DNA	12	SYNTHETIC CONSTRUCT
5'-d(gpaptpcptpcpgpapcpgpcptpcpdt cpcp*cp)-3'	C	DNA	17	SYNTHETIC CONSTRUCT

Sequence of entity 1 (A), FASTA

>4CGZ_1 BLOOM'S SYNDROME HELICASE (chains A)
SMSRNLKHERFQSLSFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGG
GKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSLDIPATYLTGDKTDSEATNIYLQL
SKKDPIIKLLYVTPEKICASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYKR
MNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKPKK
VAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQRDGLAALAYHAGLSDSARDEVQQK
WINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKSVEGYYQESGRAGRDGEISHCLLFY
TYHDVTRLKRLIMMEKDGNHHTRETHFNNLYSMVHYCENITECRRIQLLAYFGENGFNPD
FCKKHPDVSCDNCCKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNM
LVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVML
GNKAQTVLNGNLKVDFMETENSSSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVF
GVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAE
DSSPG

Sequence of entity 2 (B), FASTA

>4CGZ_2 5'-D(*AP*GP*CP*GP*TP*CP*GP*AP*GP*AP*TP*CP)-3' (chains B)
AGCGTCGAGATC

Sequence of entity 3 (C), FASTA

>4CGZ_3 5'-D(*GP*AP*TP*CP*TP*CP*GP*AP*CP*GP*CP*TP*CP*DT *CP*CP*CP)-3' (chains C)
GATCTCGACGCTCTCCC

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
ZN	Zinc ion	Zn	1

Primary citation

Crystal Structure of the Bloom'S Syndrome Helicase Indicates a Role for the Hrdc Domain in Conformational Changes. Newman, J.A., Savitsky, P., Allerston, C.K. et al. Nucleic Acids Res (2015) 43:5221. DOI 10.1093/NAR/GKV373 · PubMed

Other PDB entries of the same protein (UniProt P54132 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7XV0 1.5 Å, Crystal structure of RPA70N-BLMp1 fusion
7AUC 1.53 Å, Crystal structure of an engineered helicase domain construct for human Bloom syndrome…
7XUW 1.8 Å, Crystal structure of RPA70N-BLMp2 fusion
9P3E 2.0 Å, LC3B bound to BLM peptide
5LUP 2.03 Å, Structures of DHBN domain of human BLM helicase
5MK5 2.16 Å, Structures of DHBN domain of human BLM helicase
4O3M 2.3 Å, Ternary complex of Bloom's syndrome helicase
5U6K 2.6 Å, Crystal structure of TopBP1 BRCT4/5 in complex with a BLM phosphopeptide
3WE2 2.7 Å, Structure of BLM RQC domain bound to a phosphate ion
4CDG 2.79 Å, Crystal structure of the Bloom's syndrome helicase BLM in complex with Nanobody
3WE3 2.9 Å, Structure of BLM RQC domain bound to an arsenate ion
7AUD 2.96 Å, Structure of an engineered helicase domain construct for human Bloom syndrome protein…

Browse structure collections

About this viewer

MolViewer shows 4CGZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.